SCOP 1.63: Domain d1ef9a_: 1ef9 A:

Lineage for d1ef9a_ (1ef9 A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (3 families)

5. Family c.14.1.3: Crotonase-like [52103] (6 proteins)

6. Protein Methylmalonyl CoA decarboxylase [52110] (1 species)

7. Species Escherichia coli [TaxId:562] [52111] (2 PDB entries)

8. Domain d1ef9a_: 1ef9 A: [30924]
   complexed with 2cp

Details for d1ef9a_

PDB Entry: 1ef9, 2.7 Å

PDB Description: the crystal structure of methylmalonyl coa decarboxylase complexed with 2s-carboxypropyl coa

SCOP Domain Sequences for d1ef9a_:

Sequence; same for both SEQRES and ATOM records:

>d1ef9a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli}
msyqyvnvvtinkvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgsk
vfsaghdihelpsggrdplsyddplrqitrmiqkfpkpiismvegsvwggafemimssdl
iiaaststfsmtpvnlgvpynlvgihnltrdagfhivkeliftaspitaqralavgilnh
vveveeledftlqmahhisekaplaiavikeelrvlgeahtmnsdeferiqgmrravyds
edyqegmnaflekrkpnfvgh

Timeline for d1ef9a_:

• d1ef9a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ef9a_ appears in SCOP 1.61
  
• d1ef9a_ appears in SCOP 1.65
  
• d1ef9a_ appears in the current release, SCOPe 2.08