Lineage for d1ef9a_ (1ef9 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119892Fold c.14: ClpP/crotonase [52095] (1 superfamily)
  4. 119893Superfamily c.14.1: ClpP/crotonase [52096] (3 families) (S)
  5. 119929Family c.14.1.3: Crotonase-like [52103] (5 proteins)
  6. 119974Protein Methylmalonyl CoA decarboxylase [52110] (1 species)
  7. 119975Species Escherichia coli [TaxId:562] [52111] (2 PDB entries)
  8. 119979Domain d1ef9a_: 1ef9 A: [30924]

Details for d1ef9a_

PDB Entry: 1ef9 (more details), 2.7 Å

PDB Description: the crystal structure of methylmalonyl coa decarboxylase complexed with 2s-carboxypropyl coa

SCOP Domain Sequences for d1ef9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ef9a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli}
msyqyvnvvtinkvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgsk
vfsaghdihelpsggrdplsyddplrqitrmiqkfpkpiismvegsvwggafemimssdl
iiaaststfsmtpvnlgvpynlvgihnltrdagfhivkeliftaspitaqralavgilnh
vveveeledftlqmahhisekaplaiavikeelrvlgeahtmnsdeferiqgmrravyds
edyqegmnaflekrkpnfvgh

SCOP Domain Coordinates for d1ef9a_:

Click to download the PDB-style file with coordinates for d1ef9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ef9a_: