Lineage for d1ef9a_ (1ef9 A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.14: ClpP/crotonase [52095] (1 superfamily) Superfamily c.14.1: ClpP/crotonase [52096] (3 families) 
Family c.14.1.3: Crotonase-like [52103] (4 proteins) 
Protein Methylmalonyl CoA decarboxylase [52110] (1 species) Species Escherichia coli [TaxId:562] [52111] (2 PDB entries) 
Domain d1ef9a_: 1ef9 A: [30924]
Details for d1ef9a_
PDB Entry: 1ef9 (more details), 2.7 Å
PDB Description: the crystal structure of methylmalonyl coa decarboxylase complexed with 2s-carboxypropyl coa
SCOP Domain Sequences for d1ef9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ef9a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli}
msyqyvnvvtinkvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgsk
vfsaghdihelpsggrdplsyddplrqitrmiqkfpkpiismvegsvwggafemimssdl
iiaaststfsmtpvnlgvpynlvgihnltrdagfhivkeliftaspitaqralavgilnh
vveveeledftlqmahhisekaplaiavikeelrvlgeahtmnsdeferiqgmrravyds
edyqegmnaflekrkpnfvgh
SCOP Domain Coordinates for d1ef9a_:
Click to download the PDB-style file with coordinates for d1ef9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ef9a_:
- d1ef9a_ appears in SCOP 1.57
- d1ef9a_ appears in the current release, SCOPe 2.08
View in 3D