Lineage for d4qz7t_ (4qz7 T:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2599972Domain d4qz7t_: 4qz7 T: [309238]
    Other proteins in same PDB: d4qz7a_, d4qz7c_, d4qz7d_, d4qz7e_, d4qz7g_, d4qz7i_, d4qz7j_, d4qz7k_, d4qz7l_, d4qz7n_, d4qz7o_, d4qz7q_, d4qz7r_, d4qz7s_, d4qz7u_, d4qz7w_, d4qz7x_, d4qz7y_, d4qz7z_
    automated match to d4g4sg_
    complexed with 04c, cl, mes, mg; mutant

Details for d4qz7t_

PDB Entry: 4qz7 (more details), 2.8 Å

PDB Description: yCP beta5-A50V mutant in complex with the epoxyketone inhibitor ONX 0914
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4qz7t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qz7t_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4qz7t_:

Click to download the PDB-style file with coordinates for d4qz7t_.
(The format of our PDB-style files is described here.)

Timeline for d4qz7t_: