Lineage for d1ef8c_ (1ef8 C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21544Fold c.14: ClpP/crotonase [52095] (1 superfamily)
  4. 21545Superfamily c.14.1: ClpP/crotonase [52096] (3 families) (S)
  5. 21570Family c.14.1.3: Crotonase-like [52103] (4 proteins)
  6. 21595Protein Methylmalonyl CoA decarboxylase [52110] (1 species)
  7. 21596Species Escherichia coli [TaxId:562] [52111] (2 PDB entries)
  8. 21599Domain d1ef8c_: 1ef8 C: [30923]

Details for d1ef8c_

PDB Entry: 1ef8 (more details), 1.85 Å

PDB Description: crystal structure of methylmalonyl coa decarboxylase

SCOP Domain Sequences for d1ef8c_:

Sequence, based on SEQRES records: (download)

>d1ef8c_ c.14.1.3 (C:) Methylmalonyl CoA decarboxylase {Escherichia coli}
msyqyvnvvtinkvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgsk
vfsaghdihelpsggrdplsyddplrqitrmiqkfpkpiismvegsvwggafemimssdl
iiaaststfsmtpvnlgvpynlvgihnltrdagfhivkeliftaspitaqralavgilnh
vveveeledftlqmahhisekaplaiavikeelrvlgeahtmnsdeferiqgmrravyds
edyqegmnaflekrkpnfvgh

Sequence, based on observed residues (ATOM records): (download)

>d1ef8c_ c.14.1.3 (C:) Methylmalonyl CoA decarboxylase {Escherichia coli}
msyqyvnvvtinkvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgsk
vfsaghdlsyddplrqitrmiqkfpkpiismvegsvwggafemimssdliiaaststfsm
tpvnlgvpynlvgihnltrdagfhivkeliftaspitaqralavgilnhvveveeledft
lqmahhisekaplaiavikeelrvlgeahtmnsdeferiqgmrravydsedyqegmnafl
ekrkpnfvgh

SCOP Domain Coordinates for d1ef8c_:

Click to download the PDB-style file with coordinates for d1ef8c_.
(The format of our PDB-style files is described here.)

Timeline for d1ef8c_: