Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d4qz7c_: 4qz7 C: [309223] Other proteins in same PDB: d4qz7a_, d4qz7b_, d4qz7d_, d4qz7e_, d4qz7f_, d4qz7g_, d4qz7h_, d4qz7i_, d4qz7j_, d4qz7k_, d4qz7l_, d4qz7m_, d4qz7n_, d4qz7o_, d4qz7p_, d4qz7r_, d4qz7s_, d4qz7t_, d4qz7u_, d4qz7v_, d4qz7w_, d4qz7x_, d4qz7y_, d4qz7z_ automated match to d4eu2a_ complexed with 04c, cl, mes, mg; mutant |
PDB Entry: 4qz7 (more details), 2.8 Å
SCOPe Domain Sequences for d4qz7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qz7c_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d4qz7c_: