Lineage for d1ef8b_ (1ef8 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577845Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 577846Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 577900Family c.14.1.3: Crotonase-like [52103] (8 proteins)
  6. 577989Protein Methylmalonyl CoA decarboxylase [52110] (1 species)
  7. 577990Species Escherichia coli [TaxId:562] [52111] (2 PDB entries)
  8. 577992Domain d1ef8b_: 1ef8 B: [30922]

Details for d1ef8b_

PDB Entry: 1ef8 (more details), 1.85 Å

PDB Description: crystal structure of methylmalonyl coa decarboxylase

SCOP Domain Sequences for d1ef8b_:

Sequence, based on SEQRES records: (download)

>d1ef8b_ c.14.1.3 (B:) Methylmalonyl CoA decarboxylase {Escherichia coli}
msyqyvnvvtinkvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgsk
vfsaghdihelpsggrdplsyddplrqitrmiqkfpkpiismvegsvwggafemimssdl
iiaaststfsmtpvnlgvpynlvgihnltrdagfhivkeliftaspitaqralavgilnh
vveveeledftlqmahhisekaplaiavikeelrvlgeahtmnsdeferiqgmrravyds
edyqegmnaflekrkpnfvgh

Sequence, based on observed residues (ATOM records): (download)

>d1ef8b_ c.14.1.3 (B:) Methylmalonyl CoA decarboxylase {Escherichia coli}
msyqyvnvvtinkvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgsk
vfsaghdidplsyddplrqitrmiqkfpkpiismvegsvwggafemimssdliiaastst
fsmtpvnlgvpynlvgihnltrdagfhivkeliftaspitaqralavgilnhvveveele
dftlqmahhisekaplaiavikeelrvlgeahtmnsdeferiqgmrravydsedyqegmn
aflekrkpnfvgh

SCOP Domain Coordinates for d1ef8b_:

Click to download the PDB-style file with coordinates for d1ef8b_.
(The format of our PDB-style files is described here.)

Timeline for d1ef8b_: