Lineage for d4qz6t_ (4qz6 T:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2600037Domain d4qz6t_: 4qz6 T: [309214]
    Other proteins in same PDB: d4qz6a_, d4qz6c_, d4qz6d_, d4qz6e_, d4qz6g_, d4qz6i_, d4qz6j_, d4qz6k_, d4qz6l_, d4qz6n_, d4qz6o_, d4qz6q_, d4qz6r_, d4qz6s_, d4qz6u_, d4qz6w_, d4qz6x_, d4qz6y_, d4qz6z_
    automated match to d4g4sg_
    complexed with 04c, cl, mes, mg; mutant

Details for d4qz6t_

PDB Entry: 4qz6 (more details), 2.9 Å

PDB Description: yCP beta5-A49T-A50V double mutant in complex with the epoxyketone inhibitor ONX 0914
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4qz6t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qz6t_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4qz6t_:

Click to download the PDB-style file with coordinates for d4qz6t_.
(The format of our PDB-style files is described here.)

Timeline for d4qz6t_: