Lineage for d1dcic_ (1dci C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099550Family c.14.1.3: Crotonase-like [52103] (14 protein domains)
  6. 2099623Protein Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) [52108] (5 species)
  7. 2099638Species Norway rat (Rattus norvegicus) [TaxId:10116] [52109] (1 PDB entry)
  8. 2099641Domain d1dcic_: 1dci C: [30920]
    complexed with edo, mg, so4

Details for d1dcic_

PDB Entry: 1dci (more details), 1.5 Å

PDB Description: dienoyl-coa isomerase
PDB Compounds: (C:) dienoyl-coa isomerase

SCOPe Domain Sequences for d1dcic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dcic_ c.14.1.3 (C:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ayesiqvtsaqkhvlhvqlnrpekrnamnrafwrelvecfqkiskdsdcravvvsgagkm
ftsgidlmdmasdilqppgddvariawylrdlisryqktftviekcpkpviaaihggcig
ggvdlisacdiryctqdaffqvkevdvglaadvgtlqrlpkvignrslvneltftarkmm
adealdsglvsrvfpdkdvmlnaafalaadisskspvavqgskinliysrdhsvdesldy
matwnmsmlqtqdiiksvqaamekkdsksitfskl

SCOPe Domain Coordinates for d1dcic_:

Click to download the PDB-style file with coordinates for d1dcic_.
(The format of our PDB-style files is described here.)

Timeline for d1dcic_: