SCOPe 2.07: Domain d4qz5p_: 4qz5 P:

Lineage for d4qz5p_ (4qz5 P:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4qz5p_: 4qz5 P: [309187]
   Other proteins in same PDB: d4qz5a_, d4qz5c_, d4qz5d_, d4qz5e_, d4qz5g_, d4qz5i_, d4qz5j_, d4qz5k_, d4qz5l_, d4qz5n_, d4qz5o_, d4qz5q_, d4qz5r_, d4qz5s_, d4qz5u_, d4qz5w_, d4qz5x_, d4qz5y_, d4qz5z_
   automated match to d1rypc_
   complexed with 04c, cl, mes, mg; mutant

Details for d4qz5p_

PDB Entry: 4qz5, 2.8 Å

PDB Description: yCP beta5-A49T-mutant in complex with ONX 0914

PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4qz5p_:

Sequence; same for both SEQRES and ATOM records:

>d4qz5p_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

Timeline for d4qz5p_:

• d4qz5p_ first appeared in SCOPe 2.06
  
• d4qz5p_ appears in the current release, SCOPe 2.08