Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d4qz5b_: 4qz5 B: [309174] Other proteins in same PDB: d4qz5a_, d4qz5c1, d4qz5c2, d4qz5d_, d4qz5e_, d4qz5g_, d4qz5i_, d4qz5j_, d4qz5k_, d4qz5l_, d4qz5n_, d4qz5o_, d4qz5q1, d4qz5q2, d4qz5r_, d4qz5s_, d4qz5u_, d4qz5w_, d4qz5x_, d4qz5y_, d4qz5z_ automated match to d1rypc_ complexed with 04c, cl, mes, mg; mutant |
PDB Entry: 4qz5 (more details), 2.8 Å
SCOPe Domain Sequences for d4qz5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qz5b_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4qz5b_:
View in 3D Domains from other chains: (mouse over for more information) d4qz5a_, d4qz5c1, d4qz5c2, d4qz5d_, d4qz5e_, d4qz5f_, d4qz5g_, d4qz5h_, d4qz5i_, d4qz5j_, d4qz5k_, d4qz5l_, d4qz5m_, d4qz5n_, d4qz5o_, d4qz5p_, d4qz5q1, d4qz5q2, d4qz5r_, d4qz5s_, d4qz5t_, d4qz5u_, d4qz5v_, d4qz5w_, d4qz5x_, d4qz5y_, d4qz5z_ |