Lineage for d2dubf_ (2dub F:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119892Fold c.14: ClpP/crotonase [52095] (1 superfamily)
  4. 119893Superfamily c.14.1: ClpP/crotonase [52096] (3 families) (S)
  5. 119929Family c.14.1.3: Crotonase-like [52103] (5 proteins)
  6. 119954Protein Enoyl-CoA hydratase (crotonase) [52106] (1 species)
  7. 119955Species Rat (Rattus norvegicus) [TaxId:10116] [52107] (3 PDB entries)
  8. 119967Domain d2dubf_: 2dub F: [30917]

Details for d2dubf_

PDB Entry: 2dub (more details), 2.4 Å

PDB Description: enoyl-coa hydratase complexed with octanoyl-coa

SCOP Domain Sequences for d2dubf_:

Sequence, based on SEQRES records: (download)

>d2dubf_ c.14.1.3 (F:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus)}
anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
ekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcd
iiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
kifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatd
drregmsafvekrkanfkdh

Sequence, based on observed residues (ATOM records): (download)

>d2dubf_ c.14.1.3 (F:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus)}
anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
ekafaagadikemqnrtfqdcyshwdhitrikkpviaavngyalgggcelammcdiiyag
ekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvskifpv
etlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddrreg
msafvekrkanfkdh

SCOP Domain Coordinates for d2dubf_:

Click to download the PDB-style file with coordinates for d2dubf_.
(The format of our PDB-style files is described here.)

Timeline for d2dubf_: