Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d4qz4m_: 4qz4 M: [309160] Other proteins in same PDB: d4qz4a_, d4qz4c_, d4qz4e_, d4qz4i_, d4qz4j_, d4qz4k_, d4qz4l_, d4qz4n_, d4qz4o_, d4qz4q_, d4qz4s_, d4qz4w_, d4qz4x_, d4qz4y_, d4qz4z_ automated match to d4j70m_ complexed with 04c, cl, mes, mg; mutant |
PDB Entry: 4qz4 (more details), 3 Å
SCOPe Domain Sequences for d4qz4m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qz4m_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdi
Timeline for d4qz4m_: