Lineage for d2dubd_ (2dub D:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67869Fold c.14: ClpP/crotonase [52095] (1 superfamily)
  4. 67870Superfamily c.14.1: ClpP/crotonase [52096] (3 families) (S)
  5. 67895Family c.14.1.3: Crotonase-like [52103] (4 proteins)
  6. 67909Protein Enoyl-CoA hydratase (crotonase) [52106] (1 species)
  7. 67910Species Rat (Rattus norvegicus) [TaxId:10116] [52107] (2 PDB entries)
  8. 67914Domain d2dubd_: 2dub D: [30915]

Details for d2dubd_

PDB Entry: 2dub (more details), 2.4 Å

PDB Description: enoyl-coa hydratase complexed with octanoyl-coa

SCOP Domain Sequences for d2dubd_:

Sequence, based on SEQRES records: (download)

>d2dubd_ c.14.1.3 (D:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus)}
anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
ekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcd
iiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
kifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatd
drregmsafvekrkanfkdh

Sequence, based on observed residues (ATOM records): (download)

>d2dubd_ c.14.1.3 (D:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus)}
anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
ekafaagadikemqnrtfqdcysgkhwdhitrikkpviaavngyalgggcelammcdiiy
agekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvskif
pvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddrr
egmsafvekrkanfkdh

SCOP Domain Coordinates for d2dubd_:

Click to download the PDB-style file with coordinates for d2dubd_.
(The format of our PDB-style files is described here.)

Timeline for d2dubd_: