Lineage for d2dubc_ (2dub C:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390233Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 390234Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 390288Family c.14.1.3: Crotonase-like [52103] (7 proteins)
  6. 390327Protein Enoyl-CoA hydratase (crotonase) [52106] (2 species)
  7. 390328Species Rat (Rattus norvegicus) [TaxId:10116] [52107] (4 PDB entries)
  8. 390343Domain d2dubc_: 2dub C: [30914]

Details for d2dubc_

PDB Entry: 2dub (more details), 2.4 Å

PDB Description: enoyl-coa hydratase complexed with octanoyl-coa

SCOP Domain Sequences for d2dubc_:

Sequence, based on SEQRES records: (download)

>d2dubc_ c.14.1.3 (C:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus)}
nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
kafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdi
iyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvsk
ifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatdd
rregmsafvekrkanfkdh

Sequence, based on observed residues (ATOM records): (download)

>d2dubc_ c.14.1.3 (C:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus)}
nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
kafaagadikemqnrtfqdcyshwdhitrikkpviaavngyalgggcelammcdiiyage
kaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvskifpve
tlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddrregm
safvekrkanfkdh

SCOP Domain Coordinates for d2dubc_:

Click to download the PDB-style file with coordinates for d2dubc_.
(The format of our PDB-style files is described here.)

Timeline for d2dubc_: