Lineage for d2dubb_ (2dub B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099550Family c.14.1.3: Crotonase-like [52103] (14 protein domains)
  6. 2099644Protein Enoyl-CoA hydratase (crotonase) [52106] (2 species)
  7. 2099645Species Norway rat (Rattus norvegicus) [TaxId:10116] [52107] (4 PDB entries)
  8. 2099659Domain d2dubb_: 2dub B: [30913]
    complexed with co8

Details for d2dubb_

PDB Entry: 2dub (more details), 2.4 Å

PDB Description: enoyl-coa hydratase complexed with octanoyl-coa
PDB Compounds: (B:) 2-enoyl-coa hydratase

SCOPe Domain Sequences for d2dubb_:

Sequence, based on SEQRES records: (download)

>d2dubb_ c.14.1.3 (B:) Enoyl-CoA hydratase (crotonase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
kafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdi
iyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvsk
ifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatdd
rregmsafvekrkanfkdh

Sequence, based on observed residues (ATOM records): (download)

>d2dubb_ c.14.1.3 (B:) Enoyl-CoA hydratase (crotonase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
kafaagadikemqnrtfqdcyshwdhitrikkpviaavngyalgggcelammcdiiyage
kaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvskifpve
tlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddrregm
safvekrkanfkdh

SCOPe Domain Coordinates for d2dubb_:

Click to download the PDB-style file with coordinates for d2dubb_.
(The format of our PDB-style files is described here.)

Timeline for d2dubb_: