Lineage for d4qz3c1 (4qz3 C:1-234)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2995948Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2995983Domain d4qz3c1: 4qz3 C:1-234 [309127]
    Other proteins in same PDB: d4qz3a_, d4qz3b_, d4qz3c2, d4qz3d_, d4qz3e_, d4qz3f_, d4qz3g_, d4qz3h_, d4qz3i_, d4qz3j_, d4qz3k_, d4qz3l_, d4qz3m_, d4qz3n_, d4qz3o_, d4qz3p_, d4qz3q2, d4qz3r_, d4qz3s_, d4qz3t_, d4qz3u_, d4qz3v_, d4qz3w_, d4qz3x_, d4qz3y_, d4qz3z_
    automated match to d4eu2a_
    complexed with 04c, cl, mes, mg; mutant

Details for d4qz3c1

PDB Entry: 4qz3 (more details), 2.8 Å

PDB Description: yCP beta5-A49V mutant in complex with the epoxyketone inhibitor ONX 0914
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qz3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qz3c1 d.153.1.0 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

SCOPe Domain Coordinates for d4qz3c1:

Click to download the PDB-style file with coordinates for d4qz3c1.
(The format of our PDB-style files is described here.)

Timeline for d4qz3c1: