Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d4qz2v_: 4qz2 V: [309120] Other proteins in same PDB: d4qz2a_, d4qz2c_, d4qz2d_, d4qz2e_, d4qz2g_, d4qz2i_, d4qz2j_, d4qz2k_, d4qz2l_, d4qz2n_, d4qz2o_, d4qz2q_, d4qz2r_, d4qz2s_, d4qz2u_, d4qz2w_, d4qz2x_, d4qz2y_, d4qz2z_ automated match to d4r17h_ complexed with 04c, cl, mes, mg; mutant |
PDB Entry: 4qz2 (more details), 2.7 Å
SCOPe Domain Sequences for d4qz2v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qz2v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d4qz2v_: