Lineage for d2duba_ (2dub A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21544Fold c.14: ClpP/crotonase [52095] (1 superfamily)
  4. 21545Superfamily c.14.1: ClpP/crotonase [52096] (3 families) (S)
  5. 21570Family c.14.1.3: Crotonase-like [52103] (4 proteins)
  6. 21581Protein Enoyl-CoA hydratase (crotonase) [52106] (1 species)
  7. 21582Species Rat (Rattus norvegicus) [TaxId:10116] [52107] (2 PDB entries)
  8. 21583Domain d2duba_: 2dub A: [30912]

Details for d2duba_

PDB Entry: 2dub (more details), 2.4 Å

PDB Description: enoyl-coa hydratase complexed with octanoyl-coa

SCOP Domain Sequences for d2duba_:

Sequence, based on SEQRES records: (download)

>d2duba_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus)}
nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
kafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdi
iyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvsk
ifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatdd
rregmsafvekrkanfkdh

Sequence, based on observed residues (ATOM records): (download)

>d2duba_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus)}
nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
kafaagadikemqnrtfqdcyshwdhitrikkpviaavngyalgggcelammcdiiyage
kaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvskifpve
tlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddrregm
safvekrkanfkdh

SCOP Domain Coordinates for d2duba_:

Click to download the PDB-style file with coordinates for d2duba_.
(The format of our PDB-style files is described here.)

Timeline for d2duba_: