Lineage for d1dubf_ (1dub F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099550Family c.14.1.3: Crotonase-like [52103] (14 protein domains)
  6. 2099644Protein Enoyl-CoA hydratase (crotonase) [52106] (2 species)
  7. 2099645Species Norway rat (Rattus norvegicus) [TaxId:10116] [52107] (4 PDB entries)
  8. 2099669Domain d1dubf_: 1dub F: [30911]
    complexed with caa

Details for d1dubf_

PDB Entry: 1dub (more details), 2.5 Å

PDB Description: 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5
PDB Compounds: (F:) 2-enoyl-coa hydratase

SCOPe Domain Sequences for d1dubf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dubf_ c.14.1.3 (F:) Enoyl-CoA hydratase (crotonase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
kafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdi
iyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvsk
ifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatdd
rregmsafvekrkanfkdh

SCOPe Domain Coordinates for d1dubf_:

Click to download the PDB-style file with coordinates for d1dubf_.
(The format of our PDB-style files is described here.)

Timeline for d1dubf_: