Lineage for d1dube_ (1dub E:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21544Fold c.14: ClpP/crotonase [52095] (1 superfamily)
  4. 21545Superfamily c.14.1: ClpP/crotonase [52096] (3 families) (S)
  5. 21570Family c.14.1.3: Crotonase-like [52103] (4 proteins)
  6. 21581Protein Enoyl-CoA hydratase (crotonase) [52106] (1 species)
  7. 21582Species Rat (Rattus norvegicus) [TaxId:10116] [52107] (2 PDB entries)
  8. 21593Domain d1dube_: 1dub E: [30910]

Details for d1dube_

PDB Entry: 1dub (more details), 2.5 Å

PDB Description: 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5

SCOP Domain Sequences for d1dube_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dube_ c.14.1.3 (E:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus)}
anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
ekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcd
iiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
kifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatd
drregmsafvekrkanfkdh

SCOP Domain Coordinates for d1dube_:

Click to download the PDB-style file with coordinates for d1dube_.
(The format of our PDB-style files is described here.)

Timeline for d1dube_: