Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d4qz1v_: 4qz1 V: [309096] Other proteins in same PDB: d4qz1a_, d4qz1c_, d4qz1e_, d4qz1i_, d4qz1j_, d4qz1k_, d4qz1l_, d4qz1n_, d4qz1o_, d4qz1q_, d4qz1s_, d4qz1w_, d4qz1x_, d4qz1y_, d4qz1z_ automated match to d4r17h_ complexed with 04c, cl, mes, mg; mutant |
PDB Entry: 4qz1 (more details), 3 Å
SCOPe Domain Sequences for d4qz1v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qz1v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d4qz1v_: