SCOPe 2.07: Domain d4qz1v_: 4qz1 V:

Lineage for d4qz1v_ (4qz1 V:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4qz1v_: 4qz1 V: [309096]
   Other proteins in same PDB: d4qz1a_, d4qz1c_, d4qz1e_, d4qz1i_, d4qz1j_, d4qz1k_, d4qz1l_, d4qz1n_, d4qz1o_, d4qz1q_, d4qz1s_, d4qz1w_, d4qz1x_, d4qz1y_, d4qz1z_
   automated match to d4r17h_
   complexed with 04c, cl, mes, mg; mutant

Details for d4qz1v_

PDB Entry: 4qz1, 3 Å

PDB Description: yCP beta5-M45T mutant in complex with the epoxyketone inhibitor ONX 0914

PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4qz1v_:

Sequence; same for both SEQRES and ATOM records:

>d4qz1v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

Timeline for d4qz1v_:

• d4qz1v_ first appeared in SCOPe 2.06
  
• d4qz1v_ appears in the current release, SCOPe 2.08