Lineage for d4qz1p_ (4qz1 P:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2600249Domain d4qz1p_: 4qz1 P: [309091]
    Other proteins in same PDB: d4qz1a_, d4qz1c_, d4qz1e_, d4qz1i_, d4qz1j_, d4qz1k_, d4qz1l_, d4qz1n_, d4qz1o_, d4qz1q_, d4qz1s_, d4qz1w_, d4qz1x_, d4qz1y_, d4qz1z_
    automated match to d1rypc_
    complexed with 04c, cl, mes, mg; mutant

Details for d4qz1p_

PDB Entry: 4qz1 (more details), 3 Å

PDB Description: yCP beta5-M45T mutant in complex with the epoxyketone inhibitor ONX 0914
PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4qz1p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qz1p_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d4qz1p_:

Click to download the PDB-style file with coordinates for d4qz1p_.
(The format of our PDB-style files is described here.)

Timeline for d4qz1p_: