Lineage for d1dubc_ (1dub C:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.14: ClpP/crotonase [52095] (1 superfamily) Superfamily c.14.1: ClpP/crotonase [52096] (3 families) 
Family c.14.1.3: Crotonase-like [52103] (4 proteins) 
Protein Enoyl-CoA hydratase (crotonase) [52106] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [52107] (2 PDB entries) 
Domain d1dubc_: 1dub C: [30908]
Details for d1dubc_
PDB Entry: 1dub (more details), 2.5 Å
PDB Description: 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5
SCOP Domain Sequences for d1dubc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dubc_ c.14.1.3 (C:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus)}
nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
kafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdi
iyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvsk
ifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatdd
rregmsafvekrkanfkdh
SCOP Domain Coordinates for d1dubc_:
Click to download the PDB-style file with coordinates for d1dubc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dubc_:
- d1dubc_ appears in SCOP 1.57
- d1dubc_ appears in the current release, SCOPe 2.08
View in 3D
