Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.3: Crotonase-like [52103] (14 proteins) |
Protein Enoyl-CoA hydratase (crotonase) [52106] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [52107] (4 PDB entries) |
Domain d1dubb_: 1dub B: [30907] complexed with caa |
PDB Entry: 1dub (more details), 2.5 Å
SCOPe Domain Sequences for d1dubb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dubb_ c.14.1.3 (B:) Enoyl-CoA hydratase (crotonase) {Norway rat (Rattus norvegicus) [TaxId: 10116]} nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge kafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdi iyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvsk ifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatdd rregmsafvekrkanfkdh
Timeline for d1dubb_: