Lineage for d1dubb_ (1dub B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177168Fold c.14: ClpP/crotonase [52095] (1 superfamily)
  4. 177169Superfamily c.14.1: ClpP/crotonase [52096] (3 families) (S)
  5. 177205Family c.14.1.3: Crotonase-like [52103] (5 proteins)
  6. 177230Protein Enoyl-CoA hydratase (crotonase) [52106] (1 species)
  7. 177231Species Rat (Rattus norvegicus) [TaxId:10116] [52107] (3 PDB entries)
  8. 177245Domain d1dubb_: 1dub B: [30907]

Details for d1dubb_

PDB Entry: 1dub (more details), 2.5 Å

PDB Description: 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5

SCOP Domain Sequences for d1dubb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dubb_ c.14.1.3 (B:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus)}
nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
kafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdi
iyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvsk
ifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatdd
rregmsafvekrkanfkdh

SCOP Domain Coordinates for d1dubb_:

Click to download the PDB-style file with coordinates for d1dubb_.
(The format of our PDB-style files is described here.)

Timeline for d1dubb_: