Lineage for d1duba_ (1dub A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 310547Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 310548Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 310602Family c.14.1.3: Crotonase-like [52103] (6 proteins)
  6. 310635Protein Enoyl-CoA hydratase (crotonase) [52106] (1 species)
  7. 310636Species Rat (Rattus norvegicus) [TaxId:10116] [52107] (4 PDB entries)
  8. 310655Domain d1duba_: 1dub A: [30906]

Details for d1duba_

PDB Entry: 1dub (more details), 2.5 Å

PDB Description: 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5

SCOP Domain Sequences for d1duba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1duba_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus)}
anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
ekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcd
iiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
kifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatd
drregmsafvekrkanfkdh

SCOP Domain Coordinates for d1duba_:

Click to download the PDB-style file with coordinates for d1duba_.
(The format of our PDB-style files is described here.)

Timeline for d1duba_: