SCOPe 2.08: Domain d4qxul2: 4qxu L:113-219

Lineage for d4qxul2 (4qxu L:113-219)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4qxul2: 4qxu L:113-219 [309052]
   Other proteins in same PDB: d4qxuh_, d4qxul1
   automated match to d1blna2
   complexed with so4

Details for d4qxul2

PDB Entry: 4qxu, 2.3 Å

PDB Description: Novel Inhibition Mechanism of Membrane Metalloprotease by an Exosite-Swiveling Conformational antibody

PDB Compounds: (L:) anti_MT1-MMP light chain

SCOPe Domain Sequences for d4qxul2:

Sequence; same for both SEQRES and ATOM records:

>d4qxul2 b.1.1.2 (L:113-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d4qxul2:

• d4qxul2 first appeared in SCOPe 2.06
  
• d4qxul2 appears in SCOPe 2.07