Lineage for d1nzyc_ (1nzy C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099550Family c.14.1.3: Crotonase-like [52103] (14 protein domains)
  6. 2099551Protein 4-Chlorobenzoyl-CoA dehalogenase [52104] (1 species)
  7. 2099552Species Pseudomonas sp., strain CBS-3 [TaxId:306] [52105] (2 PDB entries)
  8. 2099555Domain d1nzyc_: 1nzy C: [30905]
    complexed with bca, ca, edo, po4

Details for d1nzyc_

PDB Entry: 1nzy (more details), 1.8 Å

PDB Description: 4-chlorobenzoyl coenzyme a dehalogenase from pseudomonas sp. strain cbs-3
PDB Compounds: (C:) 4-chlorobenzoyl Coenzyme A dehalogenase

SCOPe Domain Sequences for d1nzyc_:

Sequence, based on SEQRES records: (download)

>d1nzyc_ c.14.1.3 (C:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]}
myeaighrvedgvaeitiklprhrnalsvkamqevtdalnraeeddsvgavmitgaedaf
cagfylreipldkgvagvrdhfriaalwwhqmihkiirvkrpvlaaingvaaggglgisl
asdmaicadsakfvcawhtigigndtatsyslarivgmrramelmltnrtlypeeakdwg
lvsrvypkdefrevawkvarelaaapthlqvmakerfhagwmqpveectefeiqnviasv
thphfmpcltrfldghradrpqvelpagv

Sequence, based on observed residues (ATOM records): (download)

>d1nzyc_ c.14.1.3 (C:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]}
myeaighrvedgvaeitiklprhrnalsvkamqevtdalnraeeddsvgavmitgaedaf
cagfylreipldkgvagvrdhfriaalwwhqmihkiirvkrpvlaaingvaaggglgisl
asdmaicadsakfvcawhtigigndtatsyslarivgmrramelmltnrtlypeeakdwg
lvsrvypkdefrevawkvarelaaapthlqvmakerfhagwmqpveectefeiqnviasv
thphfmpcltrfldghadrpqvelpagv

SCOPe Domain Coordinates for d1nzyc_:

Click to download the PDB-style file with coordinates for d1nzyc_.
(The format of our PDB-style files is described here.)

Timeline for d1nzyc_: