Lineage for d4qxjq_ (4qxj Q:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602131Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2602132Protein automated matches [190509] (19 species)
    not a true protein
  7. 2602194Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2602254Domain d4qxjq_: 4qxj Q: [309042]
    Other proteins in same PDB: d4qxja_, d4qxjb_, d4qxjd_, d4qxje_, d4qxjf_, d4qxjg_, d4qxjh_, d4qxji_, d4qxjj_, d4qxjk_, d4qxjl_, d4qxjm_, d4qxjn_, d4qxjo_, d4qxjp_, d4qxjr_, d4qxjs_, d4qxjt_, d4qxju_, d4qxjv_, d4qxjw_, d4qxjx_, d4qxjy_, d4qxjz_
    automated match to d4eu2a_
    complexed with 04c, cl, mes, mg; mutant

Details for d4qxjq_

PDB Entry: 4qxj (more details), 2.8 Å

PDB Description: yCP beta5-M45A mutant in complex with the epoxyketone inhibitor ONX 0914
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qxjq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qxjq_ d.153.1.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d4qxjq_:

Click to download the PDB-style file with coordinates for d4qxjq_.
(The format of our PDB-style files is described here.)

Timeline for d4qxjq_: