Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d4qxjq_: 4qxj Q: [309042] Other proteins in same PDB: d4qxja_, d4qxjb_, d4qxjd_, d4qxje_, d4qxjf_, d4qxjg_, d4qxjh_, d4qxji_, d4qxjj_, d4qxjk_, d4qxjl_, d4qxjm_, d4qxjn_, d4qxjo_, d4qxjp_, d4qxjr_, d4qxjs_, d4qxjt_, d4qxju_, d4qxjv_, d4qxjw_, d4qxjx_, d4qxjy_, d4qxjz_ automated match to d4eu2a_ complexed with 04c, cl, mes, mg; mutant |
PDB Entry: 4qxj (more details), 2.8 Å
SCOPe Domain Sequences for d4qxjq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qxjq_ d.153.1.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d4qxjq_: