Lineage for d1nzyb_ (1nzy B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 824388Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 824389Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 824543Family c.14.1.3: Crotonase-like [52103] (13 proteins)
  6. 824544Protein 4-Chlorobenzoyl-CoA dehalogenase [52104] (1 species)
  7. 824545Species Pseudomonas sp., strain CBS-3 [TaxId:306] [52105] (2 PDB entries)
  8. 824547Domain d1nzyb_: 1nzy B: [30904]

Details for d1nzyb_

PDB Entry: 1nzy (more details), 1.8 Å

PDB Description: 4-chlorobenzoyl coenzyme a dehalogenase from pseudomonas sp. strain cbs-3
PDB Compounds: (B:) 4-chlorobenzoyl Coenzyme A dehalogenase

SCOP Domain Sequences for d1nzyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nzyb_ c.14.1.3 (B:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]}
myeaighrvedgvaeitiklprhrnalsvkamqevtdalnraeeddsvgavmitgaedaf
cagfylreipldkgvagvrdhfriaalwwhqmihkiirvkrpvlaaingvaaggglgisl
asdmaicadsakfvcawhtigigndtatsyslarivgmrramelmltdrtlypeeakdwg
lvsrvypkdefrevawkvarelaaapthlqvmakerfhagwmqpveectefeiqnviasv
thphfmpcltrfldghradrpqvelpagv

SCOP Domain Coordinates for d1nzyb_:

Click to download the PDB-style file with coordinates for d1nzyb_.
(The format of our PDB-style files is described here.)

Timeline for d1nzyb_: