SCOPe 2.07: Domain d4qxjl_: 4qxj L:

Lineage for d4qxjl_ (4qxj L:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4qxjl_: 4qxj L: [309037]
   Other proteins in same PDB: d4qxjb_, d4qxjc_, d4qxjd_, d4qxje_, d4qxjf_, d4qxjg_, d4qxjh_, d4qxjk_, d4qxjm_, d4qxjp_, d4qxjq_, d4qxjr_, d4qxjs_, d4qxjt_, d4qxju_, d4qxjv_, d4qxjy_
   automated match to d1rypm_
   complexed with 04c, cl, mes, mg; mutant

Details for d4qxjl_

PDB Entry: 4qxj, 2.8 Å

PDB Description: yCP beta5-M45A mutant in complex with the epoxyketone inhibitor ONX 0914

PDB Compounds: (L:) Proteasome subunit beta type-6

SCOPe Domain Sequences for d4qxjl_:

Sequence; same for both SEQRES and ATOM records:

>d4qxjl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

Timeline for d4qxjl_:

• d4qxjl_ first appeared in SCOPe 2.06
  
• d4qxjl_ appears in the current release, SCOPe 2.08