Lineage for d1nzya_ (1nzy A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461344Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2461345Protein 4-Chlorobenzoyl-CoA dehalogenase [52104] (1 species)
  7. 2461346Species Pseudomonas sp., strain CBS-3 [TaxId:306] [52105] (2 PDB entries)
  8. 2461347Domain d1nzya_: 1nzy A: [30903]
    complexed with bca, ca, edo, po4

Details for d1nzya_

PDB Entry: 1nzy (more details), 1.8 Å

PDB Description: 4-chlorobenzoyl coenzyme a dehalogenase from pseudomonas sp. strain cbs-3
PDB Compounds: (A:) 4-chlorobenzoyl Coenzyme A dehalogenase

SCOPe Domain Sequences for d1nzya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]}
myeaighrvedgvaeitiklprhrnalsvkamqevtdalnraeeddsvgavmitgaedaf
cagfylreipldkgvagvrdhfriaalwwhqmihkiirvkrpvlaaingvaaggglgisl
asdmaicadsakfvcawhtigigndtatsyslarivgmrramelmltnrtlypeeakdwg
lvsrvypkdefrevawkvarelaaapthlqvmakerfhagwmqpveectefeiqnviasv
thphfmpcltrfldghradrpqvelpagv

SCOPe Domain Coordinates for d1nzya_:

Click to download the PDB-style file with coordinates for d1nzya_.
(The format of our PDB-style files is described here.)

Timeline for d1nzya_: