Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d4qwxv_: 4qwx V: [309020] Other proteins in same PDB: d4qwxa_, d4qwxc_, d4qwxd_, d4qwxe_, d4qwxg_, d4qwxi_, d4qwxj_, d4qwxk_, d4qwxl_, d4qwxn_, d4qwxo_, d4qwxq_, d4qwxr_, d4qwxs_, d4qwxu_, d4qwxw_, d4qwxx_, d4qwxy_, d4qwxz_ automated match to d4r17h_ complexed with 04c, cl, mes, mg, na |
PDB Entry: 4qwx (more details), 2.9 Å
SCOPe Domain Sequences for d4qwxv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qwxv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d4qwxv_: