SCOPe 2.07: Domain d4qwxm_: 4qwx M:

Lineage for d4qwxm_ (4qwx M:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4qwxm_: 4qwx M: [309012]
   Other proteins in same PDB: d4qwxa_, d4qwxc_, d4qwxd_, d4qwxe_, d4qwxg_, d4qwxi_, d4qwxj_, d4qwxk_, d4qwxl_, d4qwxn_, d4qwxo_, d4qwxq_, d4qwxr_, d4qwxs_, d4qwxu_, d4qwxw_, d4qwxx_, d4qwxy_, d4qwxz_
   automated match to d4j70m_
   complexed with 04c, cl, mes, mg, na

Details for d4qwxm_

PDB Entry: 4qwx, 2.9 Å

PDB Description: yCP in complex with the epoxyketone inhibitor ONX 0914

PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d4qwxm_:

Sequence; same for both SEQRES and ATOM records:

>d4qwxm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

Timeline for d4qwxm_:

• d4qwxm_ first appeared in SCOPe 2.06
  
• d4qwxm_ appears in the current release, SCOPe 2.08