SCOPe 2.07: Domain d4qwxk_: 4qwx K:

Lineage for d4qwxk_ (4qwx K:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4qwxk_: 4qwx K: [309010]
   Other proteins in same PDB: d4qwxb_, d4qwxc_, d4qwxd_, d4qwxe_, d4qwxf_, d4qwxg_, d4qwxh_, d4qwxm_, d4qwxp_, d4qwxq_, d4qwxr_, d4qwxs_, d4qwxt_, d4qwxu_, d4qwxv_
   automated match to d1g0uk_
   complexed with 04c, cl, mes, mg, na

Details for d4qwxk_

PDB Entry: 4qwx, 2.9 Å

PDB Description: yCP in complex with the epoxyketone inhibitor ONX 0914

PDB Compounds: (K:) Proteasome subunit beta type-5

SCOPe Domain Sequences for d4qwxk_:

Sequence; same for both SEQRES and ATOM records:

>d4qwxk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig

Timeline for d4qwxk_:

• d4qwxk_ first appeared in SCOPe 2.06
  
• d4qwxk_ appears in the current release, SCOPe 2.08