SCOPe 2.08: Domain d4qwuc1: 4qwu C:1-234

Lineage for d4qwuc1 (4qwu C:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)

8. Domain d4qwuc1: 4qwu C:1-234 [308979]
   Other proteins in same PDB: d4qwua_, d4qwub_, d4qwuc2, d4qwue_, d4qwuf_, d4qwug_, d4qwuh_, d4qwui_, d4qwuj_, d4qwuk_, d4qwul_, d4qwum_, d4qwun_, d4qwuo_, d4qwup_, d4qwuq2, d4qwus_, d4qwut_, d4qwuu_, d4qwuv_, d4qwuw_, d4qwux_, d4qwuy_, d4qwuz_
   automated match to d4eu2a_
   complexed with bo2, cl, mg; mutant

Details for d4qwuc1

PDB Entry: 4qwu, 3 Å

PDB Description: yCP beta5-C52F mutant in complex with bortezomib

PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qwuc1:

Sequence; same for both SEQRES and ATOM records:

>d4qwuc1 d.153.1.0 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d4qwuc1:

• d4qwuc1 first appeared in SCOPe 2.06, called d4qwuc_
  
• d4qwuc1 was called d4qwuc_ in SCOPe 2.07