SCOPe 2.07: Domain d4qwst_: 4qws T:

Lineage for d4qwst_ (4qws T:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4qwst_: 4qws T: [308970]
   Other proteins in same PDB: d4qwsa_, d4qwsc_, d4qwse_, d4qwsi_, d4qwsj_, d4qwsk_, d4qwsl_, d4qwsn_, d4qwso_, d4qwsq_, d4qwss_, d4qwsw_, d4qwsx_, d4qwsy_, d4qwsz_
   automated match to d4g4sg_
   complexed with 3bv, cl, mes, mg; mutant

Details for d4qwst_

PDB Entry: 4qws, 3 Å

PDB Description: yCP beta5-C63F mutant in complex with carfilzomib

PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4qwst_:

Sequence; same for both SEQRES and ATOM records:

>d4qwst_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

Timeline for d4qwst_:

• d4qwst_ first appeared in SCOPe 2.06
  
• d4qwst_ appears in the current release, SCOPe 2.08