SCOPe 2.08: Domain d4qwsq1: 4qws Q:1-234

Lineage for d4qwsq1 (4qws Q:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)

8. Domain d4qwsq1: 4qws Q:1-234 [308968]
   Other proteins in same PDB: d4qwsa_, d4qwsb_, d4qwsc2, d4qwse_, d4qwsf_, d4qwsg_, d4qwsh_, d4qwsi_, d4qwsj_, d4qwsk_, d4qwsl_, d4qwsm_, d4qwsn_, d4qwso_, d4qwsp_, d4qwsq2, d4qwss_, d4qwst_, d4qwsu_, d4qwsv_, d4qwsw_, d4qwsx_, d4qwsy_, d4qwsz_
   automated match to d4eu2a_
   complexed with 3bv, cl, mes, mg; mutant

Details for d4qwsq1

PDB Entry: 4qws, 3 Å

PDB Description: yCP beta5-C63F mutant in complex with carfilzomib

PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qwsq1:

Sequence; same for both SEQRES and ATOM records:

>d4qwsq1 d.153.1.0 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d4qwsq1:

• d4qwsq1 first appeared in SCOPe 2.06, called d4qwsq_
  
• d4qwsq1 was called d4qwsq_ in SCOPe 2.07