Lineage for d4qwsb_ (4qws B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2600210Domain d4qwsb_: 4qws B: [308954]
    Other proteins in same PDB: d4qwsa_, d4qwsc_, d4qwse_, d4qwsi_, d4qwsj_, d4qwsk_, d4qwsl_, d4qwsn_, d4qwso_, d4qwsq_, d4qwss_, d4qwsw_, d4qwsx_, d4qwsy_, d4qwsz_
    automated match to d1rypc_
    complexed with 3bv, cl, mes, mg; mutant

Details for d4qwsb_

PDB Entry: 4qws (more details), 3 Å

PDB Description: yCP beta5-C63F mutant in complex with carfilzomib
PDB Compounds: (B:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4qwsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qwsb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d4qwsb_:

Click to download the PDB-style file with coordinates for d4qwsb_.
(The format of our PDB-style files is described here.)

Timeline for d4qwsb_: