Lineage for d4qwrc_ (4qwr C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602131Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2602132Protein automated matches [190509] (19 species)
    not a true protein
  7. 2602194Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2602271Domain d4qwrc_: 4qwr C: [308931]
    Other proteins in same PDB: d4qwra_, d4qwrb_, d4qwrd_, d4qwre_, d4qwrf_, d4qwrg_, d4qwrh_, d4qwri_, d4qwrj_, d4qwrk_, d4qwrl_, d4qwrm_, d4qwrn_, d4qwro_, d4qwrp_, d4qwrr_, d4qwrs_, d4qwrt_, d4qwru_, d4qwrv_, d4qwrw_, d4qwrx_, d4qwry_, d4qwrz_
    automated match to d4eu2a_
    complexed with 3bv, cl, mes, mg; mutant

Details for d4qwrc_

PDB Entry: 4qwr (more details), 2.9 Å

PDB Description: yCP beta5-C52F mutant in complex with carfilzomib
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qwrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qwrc_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d4qwrc_:

Click to download the PDB-style file with coordinates for d4qwrc_.
(The format of our PDB-style files is described here.)

Timeline for d4qwrc_: