Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d4qwrc_: 4qwr C: [308931] Other proteins in same PDB: d4qwra_, d4qwrb_, d4qwrd_, d4qwre_, d4qwrf_, d4qwrg_, d4qwrh_, d4qwri_, d4qwrj_, d4qwrk_, d4qwrl_, d4qwrm_, d4qwrn_, d4qwro_, d4qwrp_, d4qwrr_, d4qwrs_, d4qwrt_, d4qwru_, d4qwrv_, d4qwrw_, d4qwrx_, d4qwry_, d4qwrz_ automated match to d4eu2a_ complexed with 3bv, cl, mes, mg; mutant |
PDB Entry: 4qwr (more details), 2.9 Å
SCOPe Domain Sequences for d4qwrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qwrc_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d4qwrc_: