SCOPe 2.07: Domain d4qwlv_: 4qwl V:

Lineage for d4qwlv_ (4qwl V:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4qwlv_: 4qwl V: [308924]
   Other proteins in same PDB: d4qwla_, d4qwlc_, d4qwld_, d4qwle_, d4qwlg_, d4qwli_, d4qwlj_, d4qwlk_, d4qwll_, d4qwln_, d4qwlo_, d4qwlq_, d4qwlr_, d4qwls_, d4qwlu_, d4qwlw_, d4qwlx_, d4qwly_, d4qwlz_
   automated match to d4r17h_
   complexed with 3bv, cl, mes, mg; mutant

Details for d4qwlv_

PDB Entry: 4qwl, 2.6 Å

PDB Description: yCP beta5-A50V mutant in complex with carfilzomib

PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4qwlv_:

Sequence; same for both SEQRES and ATOM records:

>d4qwlv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

Timeline for d4qwlv_:

• d4qwlv_ first appeared in SCOPe 2.06
  
• d4qwlv_ appears in the current release, SCOPe 2.08