Lineage for d4qwlt_ (4qwl T:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2993700Domain d4qwlt_: 4qwl T: [308922]
    Other proteins in same PDB: d4qwla_, d4qwlc1, d4qwlc2, d4qwld_, d4qwle_, d4qwlg_, d4qwli_, d4qwlj_, d4qwlk_, d4qwll_, d4qwln_, d4qwlo_, d4qwlq1, d4qwlq2, d4qwlr_, d4qwls_, d4qwlu_, d4qwlw_, d4qwlx_, d4qwly_, d4qwlz_
    automated match to d4g4sg_
    complexed with 3bv, cl, mes, mg; mutant

Details for d4qwlt_

PDB Entry: 4qwl (more details), 2.6 Å

PDB Description: yCP beta5-A50V mutant in complex with carfilzomib
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4qwlt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qwlt_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4qwlt_:

Click to download the PDB-style file with coordinates for d4qwlt_.
(The format of our PDB-style files is described here.)

Timeline for d4qwlt_: