Lineage for d1tyfg_ (1tyf G:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67869Fold c.14: ClpP/crotonase [52095] (1 superfamily)
  4. 67870Superfamily c.14.1: ClpP/crotonase [52096] (3 families) (S)
  5. 67871Family c.14.1.1: Clp protease, ClpP subunit [52097] (1 protein)
  6. 67872Protein Clp protease, ClpP subunit [52098] (1 species)
  7. 67873Species Escherichia coli [TaxId:562] [52099] (1 PDB entry)
  8. 67880Domain d1tyfg_: 1tyf G: [30891]

Details for d1tyfg_

PDB Entry: 1tyf (more details), 2.2 Å

PDB Description: the structure of clpp at 2.3 angstrom resolution suggests a model for atp-dependent proteolysis

SCOP Domain Sequences for d1tyfg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyfg_ c.14.1.1 (G:) Clp protease, ClpP subunit {Escherichia coli}
srgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvi
tagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqg
qatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilt
hrn

SCOP Domain Coordinates for d1tyfg_:

Click to download the PDB-style file with coordinates for d1tyfg_.
(The format of our PDB-style files is described here.)

Timeline for d1tyfg_: