Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d4qwlc1: 4qwl C:1-234 [308907] Other proteins in same PDB: d4qwla_, d4qwlb_, d4qwlc2, d4qwld_, d4qwle_, d4qwlf_, d4qwlg_, d4qwlh_, d4qwli_, d4qwlj_, d4qwlk_, d4qwll_, d4qwlm_, d4qwln_, d4qwlo_, d4qwlp_, d4qwlq2, d4qwlr_, d4qwls_, d4qwlt_, d4qwlu_, d4qwlv_, d4qwlw_, d4qwlx_, d4qwly_, d4qwlz_ automated match to d4eu2a_ complexed with 3bv, cl, mes, mg; mutant |
PDB Entry: 4qwl (more details), 2.6 Å
SCOPe Domain Sequences for d4qwlc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qwlc1 d.153.1.0 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi
Timeline for d4qwlc1:
View in 3D Domains from other chains: (mouse over for more information) d4qwla_, d4qwlb_, d4qwld_, d4qwle_, d4qwlf_, d4qwlg_, d4qwlh_, d4qwli_, d4qwlj_, d4qwlk_, d4qwll_, d4qwlm_, d4qwln_, d4qwlo_, d4qwlp_, d4qwlq1, d4qwlq2, d4qwlr_, d4qwls_, d4qwlt_, d4qwlu_, d4qwlv_, d4qwlw_, d4qwlx_, d4qwly_, d4qwlz_ |