Lineage for d4qwkm_ (4qwk M:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2599996Domain d4qwkm_: 4qwk M: [308892]
    Other proteins in same PDB: d4qwka_, d4qwkc_, d4qwkd_, d4qwke_, d4qwkg_, d4qwki_, d4qwkj_, d4qwkk_, d4qwkl_, d4qwkn_, d4qwko_, d4qwkq_, d4qwkr_, d4qwks_, d4qwku_, d4qwkw_, d4qwkx_, d4qwky_, d4qwkz_
    automated match to d4j70m_
    complexed with 3bv, cl, mes, mg; mutant

Details for d4qwkm_

PDB Entry: 4qwk (more details), 2.8 Å

PDB Description: yCP beta5-A49T-A50V-double mutant in complex with carfilzomib
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d4qwkm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qwkm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygt

SCOPe Domain Coordinates for d4qwkm_:

Click to download the PDB-style file with coordinates for d4qwkm_.
(The format of our PDB-style files is described here.)

Timeline for d4qwkm_: