SCOPe 2.08: Domain d4qwiq1: 4qwi Q:1-234

Lineage for d4qwiq1 (4qwi Q:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)

8. Domain d4qwiq1: 4qwi Q:1-234 [308848]
   Other proteins in same PDB: d4qwia_, d4qwib_, d4qwic2, d4qwid_, d4qwie_, d4qwif_, d4qwig_, d4qwih_, d4qwii_, d4qwij_, d4qwik_, d4qwil_, d4qwim_, d4qwin_, d4qwio_, d4qwip_, d4qwiq2, d4qwir_, d4qwis_, d4qwit_, d4qwiu_, d4qwiv_, d4qwiw_, d4qwix_, d4qwiy_, d4qwiz_
   automated match to d4eu2a_
   complexed with 3bv, cl, mes, mg; mutant

Details for d4qwiq1

PDB Entry: 4qwi, 2.6 Å

PDB Description: yCP beta5-A49S-mutant in complex with carfilzomib

PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qwiq1:

Sequence; same for both SEQRES and ATOM records:

>d4qwiq1 d.153.1.0 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d4qwiq1:

• d4qwiq1 first appeared in SCOPe 2.06, called d4qwiq_
  
• d4qwiq1 was called d4qwiq_ in SCOPe 2.07