Lineage for d1aua_2 (1aua 97-299)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67851Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
  4. 67852Superfamily c.13.1: C-terminal domain of phosphatidylinositol transfer protein sec14p [52087] (1 family) (S)
  5. 67853Family c.13.1.1: C-terminal domain of phosphatidylinositol transfer protein sec14p [52088] (1 protein)
  6. 67854Protein C-terminal domain of phosphatidylinositol transfer protein sec14p [52089] (1 species)
  7. 67855Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52090] (1 PDB entry)
  8. 67856Domain d1aua_2: 1aua 97-299 [30882]
    Other proteins in same PDB: d1aua_1

Details for d1aua_2

PDB Entry: 1aua (more details), 2.5 Å

PDB Description: phosphatidylinositol transfer protein sec14p from saccharomyces cerevisiae

SCOP Domain Sequences for d1aua_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aua_2 c.13.1.1 (97-299) C-terminal domain of phosphatidylinositol transfer protein sec14p {Baker's yeast (Saccharomyces cerevisiae)}
ydekpliakfypqyyhktdkdgrpvyfeelgavnlhemnkvtseermlknlvweyesvvq
yrlpacsraaghlvetsctimdlkgisissaysvmsyvreasyisqnyypermgkfyiin
apfgfstafrlfkpfldpvtvskifilgssyqkellkqipaenlpvkfggksevdeskgg
lylsdigpwrdpkyigpegeape

SCOP Domain Coordinates for d1aua_2:

Click to download the PDB-style file with coordinates for d1aua_2.
(The format of our PDB-style files is described here.)

Timeline for d1aua_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aua_1