SCOPe 2.07: Domain d4qwgf_: 4qwg F:

Lineage for d4qwgf_ (4qwg F:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4qwgf_: 4qwg F: [308813]
   Other proteins in same PDB: d4qwga_, d4qwgc_, d4qwgd_, d4qwge_, d4qwgg_, d4qwgi_, d4qwgj_, d4qwgk_, d4qwgl_, d4qwgn_, d4qwgo_, d4qwgq_, d4qwgr_, d4qwgs_, d4qwgu_, d4qwgw_, d4qwgx_, d4qwgy_, d4qwgz_
   automated match to d4g4sg_
   complexed with 3bv, cl, mes, mg; mutant

Details for d4qwgf_

PDB Entry: 4qwg, 2.6 Å

PDB Description: yCP beta5-A49V mutant in complex with carfilzomib

PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4qwgf_:

Sequence; same for both SEQRES and ATOM records:

>d4qwgf_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

Timeline for d4qwgf_:

• d4qwgf_ first appeared in SCOPe 2.06
  
• d4qwgf_ appears in the current release, SCOPe 2.08