SCOP 1.57: Domain d1ffkl_: 1ffk L:

Lineage for d1ffkl_ (1ffk L:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)

4. Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family)

5. Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)

6. Protein Ribosomal protein L18e [52084] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [52085] (2 PDB entries)

8. Domain d1ffkl_: 1ffk L: [30881]
   Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_

Details for d1ffkl_

PDB Entry: 1ffk, 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffkl_:

Sequence; same for both SEQRES and ATOM records:

>d1ffkl_ c.12.1.1 (L:) Ribosomal protein L18e {Haloarcula marismortui}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

Timeline for d1ffkl_:

• d1ffkl_ first appeared (with stable ids) in SCOP 1.55
  
• d1ffkl_ appears in SCOP 1.59
  
• d1ffkl_ appears in the current release, SCOPe 2.08